PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00028.1.g00410.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 308aa    MW: 34172.4 Da    PI: 9.5873
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00028.1.g00410.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF961.7e-3060110151
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   krien++ rqvtf+kRrng+lKKA+ELSvLCd+eva+i+fss+g+lyeys+
  Zjn_sc00028.1.g00410.1.am.mk  60 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDVEVALIVFSSRGRLYEYSN 110
                                   79***********************************************95 PP

2K-box52.12.7e-181712263792
                         K-box  37 hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                                   hl+G+++++LslkeL+qLe++Leks+ kiR++K+ell ++i+++ k+  + +++ +
  Zjn_sc00028.1.g00410.1.am.mk 171 HLVGDSVGNLSLKELKQLESRLEKSIAKIRARKSELLASEISYMVKRIAQGEQQIQ 226
                                   9*******************************************999888777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.92752112IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-4052111IPR002100Transcription factor, MADS-box
CDDcd002653.60E-3953133No hitNo description
SuperFamilySSF554551.14E-2853116IPR002100Transcription factor, MADS-box
PROSITE patternPS00350054108IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-315474IPR002100Transcription factor, MADS-box
PfamPF003192.2E-2661108IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-317489IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-3189110IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.308146244IPR002487Transcription factor, K-box
PfamPF014864.3E-13171224IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGEAREGGTY GRQILSDTVD LPCLSGRDRE GKAERVTDLS SRSQLFRVSC RMGRGRIEIK  60
RIENTTSRQV TFCKRRNGLL KKAYELSVLC DVEVALIVFS SRGRLYEYSN NRSVDIRTHA  120
TAPFANLHRF RNCAILPYSL CLVLSSAIVR ATIERYKKAH ACGSSSGTPL HLVGDSVGNL  180
SLKELKQLES RLEKSIAKIR ARKSELLASE ISYMVKRIAQ GEQQIQQVTV AQSTAAAISM  240
EQLNPFTVLD TKCFFPAAPF AALDMKCFLP GTLQLLEAQN QMLATELNLG YQQIPAPPPG  300
TDVANHQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-1852110159Myocyte-specific enhancer factor 2B
1tqe_R5e-1852110159Myocyte-specific enhancer factor 2B
1tqe_Q5e-1852110159Myocyte-specific enhancer factor 2B
1tqe_P5e-1852110159Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0027184e-70KJ002718.1 Phyllostachys edulis MADS-box protein 13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105379.21e-107uncharacterized protein LOC542326
SwissprotQ2QW534e-80MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLB4FPN61e-107B4FPN6_MAIZE; Uncharacterized protein
TrEMBLQ423891e-107Q42389_MAIZE; MADS box protein
STRINGSi022981m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.32e-53MIKC_MADS family protein